SCOPe 2.08: Domain d2jq9a_: 2jq9 A:

Lineage for d2jq9a_ (2jq9 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.14: MIT domain [116846] (2 families)

5. Family a.7.14.0: automated matches [191520] (1 protein)
   not a true family

6. Protein automated matches [190877] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226520] (3 PDB entries)

8. Domain d2jq9a_: 2jq9 A: [148173]
   automated match to d4niqa_

Details for d2jq9a_

PDB Entry: 2jq9

PDB Description: vps4a mit-chmp1a complex

PDB Compounds: (A:) Vacuolar protein sorting-associating protein 4A

SCOPe Domain Sequences for d2jq9a_:

Sequence; same for both SEQRES and ATOM records:

>d2jq9a_ a.7.14.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tlqkaidlvtkateedkaknyeealrlyqhaveyflhaikyeahsdkakesirakcvqyl
draeklkdylr

Timeline for d2jq9a_:

• d2jq9a_ first appeared in SCOP 1.75, called d2jq9a1
  
• d2jq9a_ appears in SCOPe 2.07