Lineage for d2jq9a_ (2jq9 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696892Superfamily a.7.14: MIT domain [116846] (2 families) (S)
  5. 2696909Family a.7.14.0: automated matches [191520] (1 protein)
    not a true family
  6. 2696910Protein automated matches [190877] (3 species)
    not a true protein
  7. 2696920Species Human (Homo sapiens) [TaxId:9606] [226520] (3 PDB entries)
  8. 2696924Domain d2jq9a_: 2jq9 A: [148173]
    automated match to d4niqa_

Details for d2jq9a_

PDB Entry: 2jq9 (more details)

PDB Description: vps4a mit-chmp1a complex
PDB Compounds: (A:) Vacuolar protein sorting-associating protein 4A

SCOPe Domain Sequences for d2jq9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jq9a_ a.7.14.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tlqkaidlvtkateedkaknyeealrlyqhaveyflhaikyeahsdkakesirakcvqyl
draeklkdylr

SCOPe Domain Coordinates for d2jq9a_:

Click to download the PDB-style file with coordinates for d2jq9a_.
(The format of our PDB-style files is described here.)

Timeline for d2jq9a_: