PDB entry 2jq9

View 2jq9 on RCSB PDB site
Description: VPS4A MIT-CHMP1A complex
Class: protein transport
Keywords: CHMP1A, VPS4A MIT, Complex, Four Helix Bundle, PROTEIN TRANSPORT
Deposited on 2007-05-30, released 2007-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar protein sorting-associating protein 4A
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS4A, VPS4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jq9a_
  • Chain 'B':
    Compound: Chromatin-modifying protein 1a
    Species: Homo sapiens [TaxId:9606]
    Gene: PCOLN3, CHMP1, CHMP1A, KIAA0047, PRSM1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jq9A (A:)
    mttstlqkaidlvtkateedkaknyeealrlyqhaveyflhaikyeahsdkakesirakc
    vqyldraeklkdylrskekhgkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jq9A (A:)
    tlqkaidlvtkateedkaknyeealrlyqhaveyflhaikyeahsdkakesirakcvqyl
    draeklkdylr
    

  • Chain 'B':
    No sequence available.