Lineage for d2joya1 (2joy A:1-96)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393545Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2393849Family b.34.5.7: Ribosomal protein L14e [159031] (1 protein)
    PfamB PB032577
  6. 2393850Protein Ribosomal protein L14e [159032] (1 species)
  7. 2393851Species Sulfolobus solfataricus [TaxId:2287] [159033] (1 PDB entry)
    Uniprot Q980C1 1-96
  8. 2393852Domain d2joya1: 2joy A:1-96 [148163]

Details for d2joya1

PDB Entry: 2joy (more details)

PDB Description: nmr structure of 50s ribosomal protein l14e from sulfolobus solfataricus: northeast structural genomics consortium target ssr105
PDB Compounds: (A:) 50S ribosomal protein L14e

SCOPe Domain Sequences for d2joya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2joya1 b.34.5.7 (A:1-96) Ribosomal protein L14e {Sulfolobus solfataricus [TaxId: 2287]}
mpaievgricvkvkgreagskcvivdiiddnfvlvtgpkditgvkrrrvnilhleptdkk
idiqkgasdeevkkkleesnlteymkekikirmptl

SCOPe Domain Coordinates for d2joya1:

Click to download the PDB-style file with coordinates for d2joya1.
(The format of our PDB-style files is described here.)

Timeline for d2joya1: