| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
| Family b.34.5.7: Ribosomal protein L14e [159031] (1 protein) PfamB PB032577 |
| Protein Ribosomal protein L14e [159032] (1 species) |
| Species Sulfolobus solfataricus [TaxId:2287] [159033] (1 PDB entry) Uniprot Q980C1 1-96 |
| Domain d2joya1: 2joy A:1-96 [148163] |
PDB Entry: 2joy (more details)
SCOPe Domain Sequences for d2joya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2joya1 b.34.5.7 (A:1-96) Ribosomal protein L14e {Sulfolobus solfataricus [TaxId: 2287]}
mpaievgricvkvkgreagskcvivdiiddnfvlvtgpkditgvkrrrvnilhleptdkk
idiqkgasdeevkkkleesnlteymkekikirmptl
Timeline for d2joya1: