![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.230: Dodecin subunit-like [88797] (9 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
![]() | Superfamily d.230.6: YdgH-like [159871] (1 family) ![]() extra N-terminal structures: short strand and short helix; topological similarity to the YbjQ-like superfamily |
![]() | Family d.230.6.1: YdgH-like [159872] (2 proteins) Pfam PF07338; DUF1471 |
![]() | Protein Hypothetical protein STM0082 [159873] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [159874] (1 PDB entry) Uniprot Q7CR88 1-96 |
![]() | Domain d2jnaa1: 2jna A:1-96 [148146] Other proteins in same PDB: d2jnaa2, d2jnab3 |
PDB Entry: 2jna (more details)
SCOPe Domain Sequences for d2jnaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jnaa1 d.230.6.1 (A:1-96) Hypothetical protein STM0082 {Salmonella typhimurium [TaxId: 90371]} mkkriiaaallatvasfstlaaeqvskqeishfklvkvgtinvsqsggqisspsdlrekl seladakggkyyhiiaarehgpnfeavaevyndatk
Timeline for d2jnaa1: