Lineage for d2jnaa1 (2jna A:1-96)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007999Fold d.230: Dodecin subunit-like [88797] (9 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 3008252Superfamily d.230.6: YdgH-like [159871] (1 family) (S)
    extra N-terminal structures: short strand and short helix; topological similarity to the YbjQ-like superfamily
  5. 3008253Family d.230.6.1: YdgH-like [159872] (2 proteins)
    Pfam PF07338; DUF1471
  6. 3008254Protein Hypothetical protein STM0082 [159873] (1 species)
  7. 3008255Species Salmonella typhimurium [TaxId:90371] [159874] (1 PDB entry)
    Uniprot Q7CR88 1-96
  8. 3008256Domain d2jnaa1: 2jna A:1-96 [148146]
    Other proteins in same PDB: d2jnaa2, d2jnab3

Details for d2jnaa1

PDB Entry: 2jna (more details)

PDB Description: Solution NMR Structure of Salmonella typhimurium LT2 Secreted Protein STM0082: Northeast Structural Genomics Consortium Target StR109
PDB Compounds: (A:) putative secreted protein

SCOPe Domain Sequences for d2jnaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jnaa1 d.230.6.1 (A:1-96) Hypothetical protein STM0082 {Salmonella typhimurium [TaxId: 90371]}
mkkriiaaallatvasfstlaaeqvskqeishfklvkvgtinvsqsggqisspsdlrekl
seladakggkyyhiiaarehgpnfeavaevyndatk

SCOPe Domain Coordinates for d2jnaa1:

Click to download the PDB-style file with coordinates for d2jnaa1.
(The format of our PDB-style files is described here.)

Timeline for d2jnaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jnaa2