SCOPe 2.08: Domain d2jnab2: 2jna B:201-296

Lineage for d2jnab2 (2jna B:201-296)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.230: Dodecin subunit-like [88797] (9 superfamilies)
   beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132

4. Superfamily d.230.6: YdgH-like [159871] (1 family)
   extra N-terminal structures: short strand and short helix; topological similarity to the YbjQ-like superfamily

5. Family d.230.6.1: YdgH-like [159872] (2 proteins)
   Pfam PF07338; DUF1471

6. Protein Hypothetical protein STM0082 [159873] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [159874] (1 PDB entry)
   Uniprot Q7CR88 1-96

8. Domain d2jnab2: 2jna B:201-296 [148147]
   Other proteins in same PDB: d2jnaa2, d2jnab3
   automated match to d2jnaa1

Details for d2jnab2

PDB Entry: 2jna

PDB Description: Solution NMR Structure of Salmonella typhimurium LT2 Secreted Protein STM0082: Northeast Structural Genomics Consortium Target StR109

PDB Compounds: (B:) putative secreted protein

SCOPe Domain Sequences for d2jnab2:

Sequence; same for both SEQRES and ATOM records:

>d2jnab2 d.230.6.1 (B:201-296) Hypothetical protein STM0082 {Salmonella typhimurium [TaxId: 90371]}
mkkriiaaallatvasfstlaaeqvskqeishfklvkvgtinvsqsggqisspsdlrekl
seladakggkyyhiiaarehgpnfeavaevyndatk

Timeline for d2jnab2:

• d2jnab2 first appeared in SCOP 1.75, called d2jnab1
  
• d2jnab2 appears in SCOPe 2.07