PDB entry 2jna

View 2jna on RCSB PDB site
Description: Solution NMR Structure of Salmonella typhimurium LT2 Secreted Protein STM0082: Northeast Structural Genomics Consortium Target StR109
Class: structural genomics, unknown function
Keywords: GFT-NMR, homodimer, PSI-2, alpha+beta, putative secreted protein, Structural Genomics, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-12-31, released 2007-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative secreted protein
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM0082
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CR88
      • expression tag (96-103)
    Domains in SCOPe 2.08: d2jnaa1, d2jnaa2
  • Chain 'B':
    Compound: putative secreted protein
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM0082
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CR88 (0-95)
      • expression tag (96-103)
    Domains in SCOPe 2.08: d2jnab2, d2jnab3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jnaA (A:)
mkkriiaaallatvasfstlaaeqvskqeishfklvkvgtinvsqsggqisspsdlrekl
seladakggkyyhiiaarehgpnfeavaevyndatklehhhhhh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jnaB (B:)
mkkriiaaallatvasfstlaaeqvskqeishfklvkvgtinvsqsggqisspsdlrekl
seladakggkyyhiiaarehgpnfeavaevyndatklehhhhhh