SCOPe 2.07: Domain d2jj8a_: 2jj8 A:

Lineage for d2jj8a_ (2jj8 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Deoxyribonucleoside kinase [69478] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69479] (11 PDB entries)

8. Domain d2jj8a_: 2jj8 A: [148129]
   automated match to d1oe0a_
   complexed with azz, so4

Details for d2jj8a_

PDB Entry: 2jj8, 2.8 Å

PDB Description: Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase

PDB Compounds: (A:) deoxynucleoside kinase

SCOPe Domain Sequences for d2jj8a_:

Sequence, based on SEQRES records:

>d2jj8a_ c.37.1.1 (A:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvldad

Sequence, based on observed residues (ATOM records):

>d2jj8a_ c.37.1.1 (A:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayercvplkylqelhelhedwlihpqsckvlv
ldad

Timeline for d2jj8a_:

• d2jj8a_ first appeared in SCOP 1.75, called d2jj8a1
  
• d2jj8a_ appears in SCOPe 2.06
  
• d2jj8a_ appears in the current release, SCOPe 2.08