Lineage for d1oe0a_ (1oe0 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2473889Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2474106Protein Deoxyribonucleoside kinase [69478] (1 species)
  7. 2474107Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69479] (11 PDB entries)
  8. 2474116Domain d1oe0a_: 1oe0 A: [92788]
    complexed with mg, ttp

Details for d1oe0a_

PDB Entry: 1oe0 (more details), 2.4 Å

PDB Description: crystal structure of drosophila deoxyribonucleoside kinase in complex with dttp
PDB Compounds: (A:) Deoxyribonucleoside kinase

SCOPe Domain Sequences for d1oe0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oe0a_ c.37.1.1 (A:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvldadln

SCOPe Domain Coordinates for d1oe0a_:

Click to download the PDB-style file with coordinates for d1oe0a_.
(The format of our PDB-style files is described here.)

Timeline for d1oe0a_: