SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2ji8a3 (2ji8 A:370-565)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108258Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2108259Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2108535Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 protein domains)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 2108627Protein Oxalyl-CoA decarboxylase [142209] (1 species)
  7. 2108628Species Oxalobacter formigenes [TaxId:847] [142210] (6 PDB entries)
    Uniprot P40149 370-552
  8. 2108637Domain d2ji8a3: 2ji8 A:370-565 [148070]
    Other proteins in same PDB: d2ji8a1, d2ji8a2, d2ji8b1, d2ji8b2
    automated match to d2c31a3
    complexed with adp, fyn, mg, pge, tpp

Details for d2ji8a3

PDB Entry: 2ji8 (more details), 2.15 Å

PDB Description: x-ray structure of oxalyl-coa decarboxylase in complex with formyl-coa
PDB Compounds: (A:) oxalyl-coa decarboxylase

SCOPe Domain Sequences for d2ji8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ji8a3 c.36.1.9 (A:370-565) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]}
tpsgmmnysnslgvvrdfmlanpdislvneganaldntrmivdmlkprkrldsgtwgvmg
igmgycvaaaavtgkpviavegdsafgfsgmeleticrynlpvtviimnnggiykgnead
pqpgvisctrltrgrydmmmeafggkgyvantpaelkaaleeavasgkpclinamidpda
gvesgrikslnvvskv

SCOPe Domain Coordinates for d2ji8a3:

Click to download the PDB-style file with coordinates for d2ji8a3.
(The format of our PDB-style files is described here.)

Timeline for d2ji8a3: