Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology |
Protein Oxalyl-CoA decarboxylase [142205] (1 species) |
Species Oxalobacter formigenes [TaxId:847] [142206] (6 PDB entries) Uniprot P40149 7-194 |
Domain d2ji6b2: 2ji6 B:7-194 [148060] Other proteins in same PDB: d2ji6a1, d2ji6a3, d2ji6b1, d2ji6b3 automatically matched to d2c31a2 complexed with adp, b3p, mg, oxk, pge, tpw |
PDB Entry: 2ji6 (more details), 2.06 Å
SCOPe Domain Sequences for d2ji6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ji6b2 c.36.1.5 (B:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} veltdgfhvlidalkmndidtmygvvgipitnlarmwqddgqrfysfrheqhagyaasia gyiegkpgvcltvsapgflngvtslahattncfpmillsgssereivdlqqgdyeemdqm nvarphckasfrinsikdipigiaravrtavsgrpggvyvdlpaklfgqtisveeankll fkpidpap
Timeline for d2ji6b2: