SCOPe 2.08: Domain d2ji6b2: 2ji6 B:7-194

Lineage for d2ji6b2 (2ji6 B:7-194)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
   automatically mapped to Pfam PF02776

6. Protein Oxalyl-CoA decarboxylase [142205] (1 species)

7. Species Oxalobacter formigenes [TaxId:847] [142206] (6 PDB entries)
   Uniprot P40149 7-194

8. Domain d2ji6b2: 2ji6 B:7-194 [148060]
   Other proteins in same PDB: d2ji6a1, d2ji6a3, d2ji6b1, d2ji6b3
   automated match to d2c31a2
   complexed with adp, b3p, mg, oxk, pge, tpw

Details for d2ji6b2

PDB Entry: 2ji6, 2.06 Å

PDB Description: x-ray structure of oxalyl-coa decarboxylase in complex with 3-deaza- thdp and oxalyl-coa

PDB Compounds: (B:) oxalyl-coa decarboxylase

SCOPe Domain Sequences for d2ji6b2:

Sequence; same for both SEQRES and ATOM records:

>d2ji6b2 c.36.1.5 (B:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]}
veltdgfhvlidalkmndidtmygvvgipitnlarmwqddgqrfysfrheqhagyaasia
gyiegkpgvcltvsapgflngvtslahattncfpmillsgssereivdlqqgdyeemdqm
nvarphckasfrinsikdipigiaravrtavsgrpggvyvdlpaklfgqtisveeankll
fkpidpap

Timeline for d2ji6b2:

• d2ji6b2 first appeared in SCOP 1.75
  
• d2ji6b2 appears in SCOPe 2.07