Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins) |
Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species) |
Species Sulfolobus solfataricus [TaxId:2287] [159924] (9 PDB entries) Uniprot Q9UXC2 8-155 |
Domain d2jebb1: 2jeb B:9-155 [148017] Other proteins in same PDB: d2jeba1, d2jeba2, d2jeba3, d2jebb2, d2jebi1, d2jebi2 automated match to d2je6b1 complexed with 1pe, cl, mn |
PDB Entry: 2jeb (more details), 2.4 Å
SCOPe Domain Sequences for d2jebb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jebb1 d.14.1.4 (B:9-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]} rpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhprh lslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidvf teilqadagsrlvslmaaslaladagi
Timeline for d2jebb1: