SCOP 1.75: Domain d2jebb1: 2jeb B:9-155

Lineage for d2jebb1 (2jeb B:9-155)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins)

6. Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [159924] (7 PDB entries)
   Uniprot Q9UXC2 8-155

8. Domain d2jebb1: 2jeb B:9-155 [148017]
   Other proteins in same PDB: d2jeba1, d2jeba2, d2jebb2
   automatically matched to 2JE6 B:8-155
   complexed with 1pe, cl, mn; mutant

Details for d2jebb1

PDB Entry: 2jeb, 2.4 Å

PDB Description: structure of a 9-subunit archaeal exosome bound to mn ions

PDB Compounds: (B:) exosome complex exonuclease 1

SCOP Domain Sequences for d2jebb1:

Sequence; same for both SEQRES and ATOM records:

>d2jebb1 d.14.1.4 (B:9-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
rpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhprh
lslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidvf
teilqadagsrlvslmaaslaladagi

Timeline for d2jebb1:

• d2jebb1 is new in SCOP 1.75
  
• d2jebb1 appears in SCOPe 2.01
  
• d2jebb1 appears in the current release, SCOPe 2.08