![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) ![]() |
![]() | Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins) |
![]() | Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [159924] (7 PDB entries) Uniprot Q9UXC2 8-155 |
![]() | Domain d2jebb1: 2jeb B:9-155 [148017] Other proteins in same PDB: d2jeba1, d2jeba2, d2jebb2 automatically matched to 2JE6 B:8-155 complexed with 1pe, cl, mn; mutant |
PDB Entry: 2jeb (more details), 2.4 Å
SCOP Domain Sequences for d2jebb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jebb1 d.14.1.4 (B:9-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]} rpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhprh lslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidvf teilqadagsrlvslmaaslaladagi
Timeline for d2jebb1: