Lineage for d2jeba2 (2jeb A:192-275)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920395Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 1920396Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 1920397Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. 1920459Protein Exosome complex exonuclease 2, ECX2 [160597] (2 species)
  7. 1920473Species Sulfolobus solfataricus [TaxId:2287] [160599] (6 PDB entries)
    Uniprot Q9UXC0 192-275
  8. 1920477Domain d2jeba2: 2jeb A:192-275 [148016]
    Other proteins in same PDB: d2jeba1, d2jebb1, d2jebb2, d2jebi1, d2jebi2
    automated match to d2je6a2
    complexed with 1pe, cl, mn

Details for d2jeba2

PDB Entry: 2jeb (more details), 2.4 Å

PDB Description: structure of a 9-subunit archaeal exosome bound to mn ions
PDB Compounds: (A:) exosome complex exonuclease 2

SCOPe Domain Sequences for d2jeba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jeba2 d.101.1.1 (A:192-275) Exosome complex exonuclease 2, ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi
dqaentarstavklleelkkhlgi

SCOPe Domain Coordinates for d2jeba2:

Click to download the PDB-style file with coordinates for d2jeba2.
(The format of our PDB-style files is described here.)

Timeline for d2jeba2: