Lineage for d2jebb1 (2jeb B:9-155)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891698Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1891699Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1891941Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 1891942Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species)
  7. 1891950Species Sulfolobus solfataricus [TaxId:2287] [159924] (9 PDB entries)
    Uniprot Q9UXC2 8-155
  8. 1891954Domain d2jebb1: 2jeb B:9-155 [148017]
    Other proteins in same PDB: d2jeba1, d2jeba2, d2jebb2, d2jebi1, d2jebi2
    automated match to d2je6b1
    complexed with 1pe, cl, mn

Details for d2jebb1

PDB Entry: 2jeb (more details), 2.4 Å

PDB Description: structure of a 9-subunit archaeal exosome bound to mn ions
PDB Compounds: (B:) exosome complex exonuclease 1

SCOPe Domain Sequences for d2jebb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jebb1 d.14.1.4 (B:9-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
rpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhprh
lslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidvf
teilqadagsrlvslmaaslaladagi

SCOPe Domain Coordinates for d2jebb1:

Click to download the PDB-style file with coordinates for d2jebb1.
(The format of our PDB-style files is described here.)

Timeline for d2jebb1: