![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
![]() | Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family) ![]() |
![]() | Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (10 proteins) |
![]() | Protein Exosome complex exonuclease 2, ECX2 [160597] (2 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [160599] (7 PDB entries) Uniprot Q9UXC0 192-275 |
![]() | Domain d2jeba2: 2jeb A:192-275 [148016] Other proteins in same PDB: d2jeba1, d2jebb1, d2jebb2 automatically matched to 2JE6 A:192-275 complexed with 1pe, cl, mn; mutant |
PDB Entry: 2jeb (more details), 2.4 Å
SCOP Domain Sequences for d2jeba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jeba2 d.101.1.1 (A:192-275) Exosome complex exonuclease 2, ECX2 {Sulfolobus solfataricus [TaxId: 2287]} plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi dqaentarstavklleelkkhlgi
Timeline for d2jeba2: