Lineage for d2j9ga2 (2j9g A:1-114)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 985731Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 985732Superfamily c.30.1: PreATP-grasp domain [52440] (8 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 985733Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 985740Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 985743Species Escherichia coli [TaxId:562] [52443] (7 PDB entries)
  8. 985746Domain d2j9ga2: 2j9g A:1-114 [147938]
    Other proteins in same PDB: d2j9ga1, d2j9ga3, d2j9gb1, d2j9gb3
    automatically matched to d1dv2a2
    complexed with adp, anp, mg, so4

Details for d2j9ga2

PDB Entry: 2j9g (more details), 2.05 Å

PDB Description: crystal structure of biotin carboxylase from e. coli in complex with amppnp and adp
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d2j9ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j9ga2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

SCOPe Domain Coordinates for d2j9ga2:

Click to download the PDB-style file with coordinates for d2j9ga2.
(The format of our PDB-style files is described here.)

Timeline for d2j9ga2: