| Class b: All beta proteins [48724] (174 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) ![]() |
| Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins) probable rudiment form of the biotinyl-carrier domain |
| Protein Biotin carboxylase (BC), C-domain [51248] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
| Species Escherichia coli [TaxId:562] [51249] (7 PDB entries) |
| Domain d2j9ga1: 2j9g A:331-446 [147937] Other proteins in same PDB: d2j9ga2, d2j9ga3, d2j9gb2, d2j9gb3 automatically matched to d1bncb1 complexed with adp, anp, mg, so4 |
PDB Entry: 2j9g (more details), 2.05 Å
SCOPe Domain Sequences for d2j9ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j9ga1 b.84.2.1 (A:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklgl
Timeline for d2j9ga1: