![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries) |
![]() | Domain d2j8um1: 2j8u M:1-117 [147929] Other proteins in same PDB: d2j8ua1, d2j8ua2, d2j8ub2, d2j8ub3, d2j8ue2, d2j8uf2, d2j8uh1, d2j8uh2, d2j8ui2, d2j8ui3, d2j8ul2, d2j8um2 automatically matched to d1lp9f1 mutant |
PDB Entry: 2j8u (more details), 2.88 Å
SCOPe Domain Sequences for d2j8um1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j8um1 b.1.1.1 (M:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} eaavtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdi pdgykasrpsqenfslilelaslsqtavyfcassdwvsyeqyfgpgtrltvle
Timeline for d2j8um1: