Lineage for d2j8ue1 (2j8u E:0-117)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741896Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2742002Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (22 PDB entries)
  8. 2742029Domain d2j8ue1: 2j8u E:0-117 [147920]
    Other proteins in same PDB: d2j8ua1, d2j8ua2, d2j8ub2, d2j8ub3, d2j8ue2, d2j8uf2, d2j8uh1, d2j8uh2, d2j8ui2, d2j8ui3, d2j8ul2, d2j8um2
    automatically matched to d1lp9e1
    mutant

Details for d2j8ue1

PDB Entry: 2j8u (more details), 2.88 Å

PDB Description: large cdr3a loop alteration as a function of mhc mutation.
PDB Compounds: (E:) ahiii tcr alpha chain

SCOPe Domain Sequences for d2j8ue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j8ue1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
mdsvtqteglvtlteglpvmlnctyqstyspflfwyvqhlneapklllksftdnkrpehq
gfhatlhkssssfhlqkssaqlsdsalyycalflasssfsklvfgqgtslsvvpn

SCOPe Domain Coordinates for d2j8ue1:

Click to download the PDB-style file with coordinates for d2j8ue1.
(The format of our PDB-style files is described here.)

Timeline for d2j8ue1: