SCOPe 2.08: Domain d2j8ue2: 2j8u E:118-198

Lineage for d2j8ue2 (2j8u E:118-198)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein T-cell antigen receptor [49125] (7 species)
Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (11 PDB entries)

Domain d2j8ue2: 2j8u E:118-198 [147921]
Other proteins in same PDB: d2j8ua1, d2j8ua2, d2j8ub2, d2j8ub3, d2j8ue1, d2j8uf1, d2j8uh1, d2j8uh2, d2j8ui2, d2j8ui3, d2j8ul1, d2j8um1
automatically matched to d1lp9e2
mutant

Details for d2j8ue2

PDB Entry: 2j8u (more details), 2.88 Å

PDB Description: large cdr3a loop alteration as a function of mhc mutation.

PDB Compounds: (E:) ahiii tcr alpha chain

SCOPe Domain Sequences for d2j8ue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j8ue2 b.1.1.2 (E:118-198) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdktvldmkamdsksng
aiawsnqtsftcqdifket

SCOPe Domain Coordinates for d2j8ue2:

Click to download the PDB-style file with coordinates for d2j8ue2.
(The format of our PDB-style files is described here.)

Timeline for d2j8ue2: