SCOPe 2.05: Domain d2j4ga1: 2j4g A:437-589

Lineage for d2j4ga1 (2j4g A:437-589)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
   5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology

4. Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families)

5. Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins)

6. Protein Glucosaminidase GH84 post-catalytic domain [140661] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [140662] (8 PDB entries)
   Uniprot Q89ZI2 458-610! Uniprot Q89ZI2 458-611

8. Domain d2j4ga1: 2j4g A:437-589 [147876]
   Other proteins in same PDB: d2j4ga2, d2j4ga3, d2j4gb2, d2j4gb3
   complexed with act, gol, nb1

Details for d2j4ga1

PDB Entry: 2j4g, 2.25 Å

PDB Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with n-butyl-thiazoline inhibitor

PDB Compounds: (A:) Hyaluronoglucosaminidase

SCOPe Domain Sequences for d2j4ga1:

Sequence; same for both SEQRES and ATOM records:

>d2j4ga1 a.246.1.1 (A:437-589) Glucosaminidase GH84 post-catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt
atrvikplidrtfatvvkffnqkfnahldattd

Timeline for d2j4ga1:

• d2j4ga1 first appeared in SCOP 1.75
  
• d2j4ga1 appears in SCOPe 2.04
  
• d2j4ga1 appears in SCOPe 2.06
  
• d2j4ga1 appears in the current release, SCOPe 2.08