Lineage for d2j4ga1 (2j4g A:437-589)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738194Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 2738195Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) (S)
  5. 2738196Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins)
  6. 2738197Protein Glucosaminidase GH84 post-catalytic domain [140661] (1 species)
  7. 2738198Species Bacteroides thetaiotaomicron [TaxId:818] [140662] (8 PDB entries)
    Uniprot Q89ZI2 458-610! Uniprot Q89ZI2 458-611
  8. 2738205Domain d2j4ga1: 2j4g A:437-589 [147876]
    Other proteins in same PDB: d2j4ga2, d2j4ga3, d2j4gb2, d2j4gb3
    complexed with act, gol, nb1

Details for d2j4ga1

PDB Entry: 2j4g (more details), 2.25 Å

PDB Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with n-butyl-thiazoline inhibitor
PDB Compounds: (A:) Hyaluronoglucosaminidase

SCOPe Domain Sequences for d2j4ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j4ga1 a.246.1.1 (A:437-589) Glucosaminidase GH84 post-catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt
atrvikplidrtfatvvkffnqkfnahldattd

SCOPe Domain Coordinates for d2j4ga1:

Click to download the PDB-style file with coordinates for d2j4ga1.
(The format of our PDB-style files is described here.)

Timeline for d2j4ga1: