SCOPe 2.07: Domain d2iybc_: 2iyb C:

Lineage for d2iybc_ (2iyb C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)

6. Protein Enabled [50768] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159215] (2 PDB entries)

8. Domain d2iybc_: 2iyb C: [147838]
   automated match to d1evha_
   complexed with zn

Details for d2iybc_

PDB Entry: 2iyb, 2.35 Å

PDB Description: structure of complex between the 3rd lim domain of tes and the evh1 domain of mena

PDB Compounds: (C:) Protein enabled homolog

SCOPe Domain Sequences for d2iybc_:

Sequence; same for both SEQRES and ATOM records:

>d2iybc_ b.55.1.4 (C:) Enabled {Human (Homo sapiens) [TaxId: 9606]}
seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvin
caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns

Timeline for d2iybc_:

• d2iybc_ first appeared in SCOP 1.75, called d2iybc1
  
• d2iybc_ appears in SCOPe 2.06
  
• d2iybc_ appears in the current release, SCOPe 2.08