Lineage for d2iybc_ (2iyb C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)
  6. Protein Enabled [50768] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [159215] (2 PDB entries)
  8. Domain d2iybc_: 2iyb C: [147838]
    Other proteins in same PDB: d2iyba3
    automated match to d1evha_
    complexed with zn

Details for d2iybc_

PDB Entry: 2iyb (more details), 2.3499999999999996 Å

PDB Description: structure of complex between the 3rd lim domain of tes and the evh1 domain of mena
PDB Compounds: (C:) Protein enabled homolog

SCOPe Domain Sequences for d2iybc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iybc_ b.55.1.4 (C:) Enabled {Human (Homo sapiens) [TaxId: 9606]}
seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvin
caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns

SCOPe Domain Coordinates for d2iybc_ are not available.

Timeline for d2iybc_:

Domains from other chains:
(mouse over for more information)
d2iyba2, d2iyba3, d2iybb_, d2iybd_