Lineage for d2ix0a2 (2ix0 A:4-82)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2059775Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 2059835Protein Exoribonuclease 2, RNB [159089] (1 species)
    RNase II; contains 3 S1-like domains in addition to an OB-fold embedded in the catalytic domain
  7. 2059836Species Escherichia coli [TaxId:562] [159090] (3 PDB entries)
    Uniprot P30850 1-82! Uniprot P30850 4-82! Uniprot P30850 5-82! Uniprot P30850 558-643! Uniprot P30850 558-644! Uniprot P30850 83-172
  8. 2059838Domain d2ix0a2: 2ix0 A:4-82 [147819]
    Other proteins in same PDB: d2ix0a4
    complexed with c5p, ca, mg

Details for d2ix0a2

PDB Entry: 2ix0 (more details), 2.44 Å

PDB Description: rnase ii
PDB Compounds: (A:) Exoribonuclease 2

SCOPe Domain Sequences for d2ix0a2:

Sequence, based on SEQRES records: (download)

>d2ix0a2 b.40.4.5 (A:4-82) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]}
ddpllaqlkqqlhsqtpraegvvkatekgfgflevdaqksyfipppqmkkvmhgdriiav
ihsekeresaepeelvepf

Sequence, based on observed residues (ATOM records): (download)

>d2ix0a2 b.40.4.5 (A:4-82) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]}
ddpllaqlkqqlhsqtpraegvvkatefgflevdaqksyfipppqmkkvmhgdriiavih
seresaepeelvepf

SCOPe Domain Coordinates for d2ix0a2:

Click to download the PDB-style file with coordinates for d2ix0a2.
(The format of our PDB-style files is described here.)

Timeline for d2ix0a2: