Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
Protein Exoribonuclease 2, RNB, N-terminal domain [418920] (1 species) RNase II; protein contains 3 S1-like domains in addition to an OB-fold embedded in the catalytic domain |
Species Escherichia coli [TaxId:562] [419348] (3 PDB entries) Uniprot P30850 |
Domain d2ix0a2: 2ix0 A:4-82 [147819] Other proteins in same PDB: d2ix0a1, d2ix0a3, d2ix0a4 complexed with c5p, ca, mg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2ix0 (more details), 2.44 Å
SCOPe Domain Sequences for d2ix0a2:
Sequence, based on SEQRES records: (download)
>d2ix0a2 b.40.4.5 (A:4-82) Exoribonuclease 2, RNB, N-terminal domain {Escherichia coli [TaxId: 562]} ddpllaqlkqqlhsqtpraegvvkatekgfgflevdaqksyfipppqmkkvmhgdriiav ihsekeresaepeelvepf
>d2ix0a2 b.40.4.5 (A:4-82) Exoribonuclease 2, RNB, N-terminal domain {Escherichia coli [TaxId: 562]} ddpllaqlkqqlhsqtpraegvvkatefgflevdaqksyfipppqmkkvmhgdriiavih seresaepeelvepf
Timeline for d2ix0a2: