Lineage for d2iu5b1 (2iu5 B:4-71)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305653Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2305937Protein Transcriptional activator DhaS [158248] (1 species)
  7. 2305938Species Lactococcus lactis [TaxId:1358] [158249] (1 PDB entry)
    Uniprot Q9CIV9 8-78
  8. 2305940Domain d2iu5b1: 2iu5 B:4-71 [147803]
    Other proteins in same PDB: d2iu5a2, d2iu5b2, d2iu5b3
    automated match to d2iu5a1

Details for d2iu5b1

PDB Entry: 2iu5 (more details), 1.6 Å

PDB Description: dihydroxyacetone kinase operon activator dhas
PDB Compounds: (B:) hth-type dhaklm operon transcriptional activator dhas

SCOPe Domain Sequences for d2iu5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iu5b1 a.4.1.9 (B:4-71) Transcriptional activator DhaS {Lactococcus lactis [TaxId: 1358]}
siitqkiiakafkdlmqsnayhqisvsdimqtakirrqtfynyfqnqeellswifendfa
elindnsd

SCOPe Domain Coordinates for d2iu5b1:

Click to download the PDB-style file with coordinates for d2iu5b1.
(The format of our PDB-style files is described here.)

Timeline for d2iu5b1: