SCOPe 2.08: Domain d2iu5b1: 2iu5 B:4-71

Lineage for d2iu5b1 (2iu5 B:4-71)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Transcriptional activator DhaS [158248] (1 species)

7. Species Lactococcus lactis [TaxId:1358] [158249] (1 PDB entry)
   Uniprot Q9CIV9 8-78

8. Domain d2iu5b1: 2iu5 B:4-71 [147803]
   Other proteins in same PDB: d2iu5a2, d2iu5b2, d2iu5b3
   automated match to d2iu5a1

Details for d2iu5b1

PDB Entry: 2iu5, 1.6 Å

PDB Description: dihydroxyacetone kinase operon activator dhas

PDB Compounds: (B:) hth-type dhaklm operon transcriptional activator dhas

SCOPe Domain Sequences for d2iu5b1:

Sequence; same for both SEQRES and ATOM records:

>d2iu5b1 a.4.1.9 (B:4-71) Transcriptional activator DhaS {Lactococcus lactis [TaxId: 1358]}
siitqkiiakafkdlmqsnayhqisvsdimqtakirrqtfynyfqnqeellswifendfa
elindnsd

Timeline for d2iu5b1:

• d2iu5b1 first appeared in SCOP 1.75
  
• d2iu5b1 appears in SCOPe 2.07