Lineage for d2inba1 (2inb A:5-139)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1170597Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1170598Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 1170967Family c.52.1.32: XisH-like [159601] (1 protein)
    Pfam PF08814
  6. 1170968Protein FdxN element excision controlling factor protein [159602] (2 species)
  7. 1170972Species Nostoc punctiforme [TaxId:272131] [159603] (1 PDB entry)
  8. 1170973Domain d2inba1: 2inb A:5-139 [147738]
    complexed with cl, gol

Details for d2inba1

PDB Entry: 2inb (more details), 1.6 Å

PDB Description: crystal structure of an xish family protein (zp_00107633.1) from nostoc punctiforme pcc 73102 at 1.60 a resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2inba1:

Sequence, based on SEQRES records: (download)

>d2inba1 c.52.1.32 (A:5-139) FdxN element excision controlling factor protein {Nostoc punctiforme [TaxId: 272131]}
dvfhqvvkialekdgwqitndpltisvggvnlsidlgaekliaaeregekiavevksfle
rssaisefhtalgqfinyrgalrrrqpervlylavplttyktffqldfpkemiaenqvkm
liydveqevifqwin

Sequence, based on observed residues (ATOM records): (download)

>d2inba1 c.52.1.32 (A:5-139) FdxN element excision controlling factor protein {Nostoc punctiforme [TaxId: 272131]}
dvfhqvvkialekdgwqitndpltisvggvnlkliaaeregekiavevksflerssaise
fhtalgqfinyrgalrrrqpervlylavplttyktffqldfpkemiaenqvkmliydveq
evifqwin

SCOPe Domain Coordinates for d2inba1:

Click to download the PDB-style file with coordinates for d2inba1.
(The format of our PDB-style files is described here.)

Timeline for d2inba1: