SCOP 1.75: Domain d2inba1: 2inb A:5-139

Lineage for d2inba1 (2inb A:5-139)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (33 families)

5. Family c.52.1.32: XisH-like [159601] (1 protein)
   Pfam PF08814

6. Protein FdxN element excision controlling factor protein [159602] (2 species)

7. Species Nostoc punctiforme [TaxId:272131] [159603] (1 PDB entry)

8. Domain d2inba1: 2inb A:5-139 [147738]
   complexed with cl, gol

Details for d2inba1

PDB Entry: 2inb, 1.6 Å

PDB Description: crystal structure of an xish family protein (zp_00107633.1) from nostoc punctiforme pcc 73102 at 1.60 a resolution

PDB Compounds: (A:) hypothetical protein

SCOP Domain Sequences for d2inba1:

Sequence, based on SEQRES records:

>d2inba1 c.52.1.32 (A:5-139) FdxN element excision controlling factor protein {Nostoc punctiforme [TaxId: 272131]}
dvfhqvvkialekdgwqitndpltisvggvnlsidlgaekliaaeregekiavevksfle
rssaisefhtalgqfinyrgalrrrqpervlylavplttyktffqldfpkemiaenqvkm
liydveqevifqwin

Sequence, based on observed residues (ATOM records):

>d2inba1 c.52.1.32 (A:5-139) FdxN element excision controlling factor protein {Nostoc punctiforme [TaxId: 272131]}
dvfhqvvkialekdgwqitndpltisvggvnlkliaaeregekiavevksflerssaise
fhtalgqfinyrgalrrrqpervlylavplttyktffqldfpkemiaenqvkmliydveq
evifqwin

Timeline for d2inba1:

• d2inba1 is new in SCOP 1.75
  
• d2inba1 appears in SCOPe 2.01
  
• d2inba1 appears in the current release, SCOPe 2.08