Lineage for d2ihna1 (2ihn A:183-305)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1999281Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) (S)
  5. 1999282Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 protein domains)
  6. 1999307Protein T4 RNase H [47809] (1 species)
  7. 1999308Species Bacteriophage T4 [TaxId:10665] [47810] (6 PDB entries)
  8. 1999314Domain d2ihna1: 2ihn A:183-305 [147679]
    Other proteins in same PDB: d2ihna2
    automatically matched to d1tfra1
    protein/DNA complex

Details for d2ihna1

PDB Entry: 2ihn (more details), 3 Å

PDB Description: Co-crystal of Bacteriophage T4 RNase H with a fork DNA substrate
PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d2ihna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ihna1 a.60.7.1 (A:183-305) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
gsaeidcmtkilkgdkkdnvasvkvrsdfwftrvegertpsmktsiveaiandreqakvl
lteseynrykenlvlidfdyipdniasnivnyynsyklpprgkiysyfvkaglskltnsi
nef

SCOPe Domain Coordinates for d2ihna1:

Click to download the PDB-style file with coordinates for d2ihna1.
(The format of our PDB-style files is described here.)

Timeline for d2ihna1: