SCOPe 2.08: Domain d2ihna1: 2ihn A:183-305

Lineage for d2ihna1 (2ihn A:183-305)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families)

5. Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)

6. Protein T4 RNase H [47809] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [47810] (6 PDB entries)

8. Domain d2ihna1: 2ihn A:183-305 [147679]
   Other proteins in same PDB: d2ihna2
   automatically matched to d1tfra1
   protein/DNA complex

Details for d2ihna1

PDB Entry: 2ihn, 3 Å

PDB Description: co-crystal of bacteriophage t4 rnase h with a fork dna substrate

PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d2ihna1:

Sequence; same for both SEQRES and ATOM records:

>d2ihna1 a.60.7.1 (A:183-305) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
gsaeidcmtkilkgdkkdnvasvkvrsdfwftrvegertpsmktsiveaiandreqakvl
lteseynrykenlvlidfdyipdniasnivnyynsyklpprgkiysyfvkaglskltnsi
nef

Timeline for d2ihna1:

• d2ihna1 first appeared in SCOP 1.75
  
• d2ihna1 appears in SCOPe 2.07