Lineage for d2igse1 (2igs E:4-215)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 850027Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 850028Superfamily d.2.1: Lysozyme-like [53955] (11 families) (S)
  5. 851257Family d.2.1.11: PA2222-like [159837] (1 protein)
    PfamB PB104465
  6. 851258Protein Hypothetical protein PA2222 [159838] (1 species)
  7. 851259Species Pseudomonas aeruginosa [TaxId:287] [159839] (1 PDB entry)
    Uniprot Q9I1P7 4-215
  8. 851264Domain d2igse1: 2igs E:4-215 [147663]
    automatically matched to 2IGS A:4-215
    complexed with acy, gol, so4

Details for d2igse1

PDB Entry: 2igs (more details), 2.17 Å

PDB Description: crystal structure of the protein of unknown function from pseudomonas aeruginosa
PDB Compounds: (E:) hypothetical protein

SCOP Domain Sequences for d2igse1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2igse1 d.2.1.11 (E:4-215) Hypothetical protein PA2222 {Pseudomonas aeruginosa [TaxId: 287]}
iniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdiskadqqy
stllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldrfkgsp
nvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpgvglrl
dapnfsdvfntiksglryttavtlllayfaai

SCOP Domain Coordinates for d2igse1:

Click to download the PDB-style file with coordinates for d2igse1.
(The format of our PDB-style files is described here.)

Timeline for d2igse1: