![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (11 families) ![]() |
![]() | Family d.2.1.11: PA2222-like [159837] (1 protein) PfamB PB104465 |
![]() | Protein Hypothetical protein PA2222 [159838] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [159839] (1 PDB entry) Uniprot Q9I1P7 4-215 |
![]() | Domain d2igsd1: 2igs D:4-215 [147662] automatically matched to 2IGS A:4-215 complexed with acy, gol, so4 |
PDB Entry: 2igs (more details), 2.17 Å
SCOP Domain Sequences for d2igsd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2igsd1 d.2.1.11 (D:4-215) Hypothetical protein PA2222 {Pseudomonas aeruginosa [TaxId: 287]} iniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdiskadqqy stllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldrfkgsp nvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpgvglrl dapnfsdvfntiksglryttavtlllayfaai
Timeline for d2igsd1: