![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.11: PA2222-like [159837] (2 proteins) PfamB PB104465 automatically mapped to Pfam PF11508 |
![]() | Protein automated matches [190711] (1 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [187858] (1 PDB entry) |
![]() | Domain d2igse2: 2igs E:3-215 [147663] Other proteins in same PDB: d2igsa1, d2igsa2, d2igsc3, d2igsd3, d2igse3, d2igsf3, d2igsg3, d2igsh3 automated match to d2igsa1 complexed with acy, gol, so4 |
PDB Entry: 2igs (more details), 2.17 Å
SCOPe Domain Sequences for d2igse2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2igse2 d.2.1.11 (E:3-215) automated matches {Pseudomonas aeruginosa [TaxId: 287]} einiyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdiskadqq ystllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldrfkgs pnvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpgvglr ldapnfsdvfntiksglryttavtlllayfaai
Timeline for d2igse2: