Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) |
Family d.218.1.12: Iojap/YbeB-like [160252] (3 proteins) Pfam PF02410, probably has evolved a different function; closer relationship to the GrpB-like family |
Protein Hypothetical protein CV0518 [160253] (1 species) |
Species Chromobacterium violaceum [TaxId:536] [160254] (1 PDB entry) Uniprot Q7P0P8 1-120 |
Domain d2id1a1: 2id1 A:1-120 [147622] complexed with iod |
PDB Entry: 2id1 (more details), 3 Å
SCOPe Domain Sequences for d2id1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2id1a1 d.218.1.12 (A:1-120) Hypothetical protein CV0518 {Chromobacterium violaceum [TaxId: 536]} meiqeisklaiealedikgkdiieldtskltslfqrmivatgdsnrqvkalansvqvklk eagvdivgseghesgewvlvdagdvvvhvmlpavrdyydiealwggqkpsfavgaakpws
Timeline for d2id1a1: