Lineage for d2id1a1 (2id1 A:1-120)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3007332Family d.218.1.12: Iojap/YbeB-like [160252] (3 proteins)
    Pfam PF02410, probably has evolved a different function; closer relationship to the GrpB-like family
  6. 3007333Protein Hypothetical protein CV0518 [160253] (1 species)
  7. 3007334Species Chromobacterium violaceum [TaxId:536] [160254] (1 PDB entry)
    Uniprot Q7P0P8 1-120
  8. 3007335Domain d2id1a1: 2id1 A:1-120 [147622]
    complexed with iod

Details for d2id1a1

PDB Entry: 2id1 (more details), 3 Å

PDB Description: x-ray crystal structure of protein cv0518 from chromobacterium violaceum, northeast structural genomics consortium target cvr5.
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2id1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2id1a1 d.218.1.12 (A:1-120) Hypothetical protein CV0518 {Chromobacterium violaceum [TaxId: 536]}
meiqeisklaiealedikgkdiieldtskltslfqrmivatgdsnrqvkalansvqvklk
eagvdivgseghesgewvlvdagdvvvhvmlpavrdyydiealwggqkpsfavgaakpws

SCOPe Domain Coordinates for d2id1a1:

Click to download the PDB-style file with coordinates for d2id1a1.
(The format of our PDB-style files is described here.)

Timeline for d2id1a1: