SCOPe 2.08: Domain d2id1b_: 2id1 B:

Lineage for d2id1b_ (2id1 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.12: Iojap/YbeB-like [160252] (3 proteins)
   Pfam PF02410, probably has evolved a different function; closer relationship to the GrpB-like family

6. Protein Hypothetical protein CV0518 [160253] (1 species)

7. Species Chromobacterium violaceum [TaxId:536] [160254] (1 PDB entry)
   Uniprot Q7P0P8 1-120

8. Domain d2id1b_: 2id1 B: [147623]
   automated match to d2id1a1
   complexed with iod

Details for d2id1b_

PDB Entry: 2id1, 3 Å

PDB Description: x-ray crystal structure of protein cv0518 from chromobacterium violaceum, northeast structural genomics consortium target cvr5.

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2id1b_:

Sequence; same for both SEQRES and ATOM records:

>d2id1b_ d.218.1.12 (B:) Hypothetical protein CV0518 {Chromobacterium violaceum [TaxId: 536]}
meiqeisklaiealedikgkdiieldtskltslfqrmivatgdsnrqvkalansvqvklk
eagvdivgseghesgewvlvdagdvvvhvmlpavrdyydiealwggqkpsfavgaakpws

Timeline for d2id1b_:

• d2id1b_ first appeared in SCOP 1.75, called d2id1b1
  
• d2id1b_ appears in SCOPe 2.07