Lineage for d2ic1a1 (2ic1 A:6-190)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1330392Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1330393Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1330857Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. 1330858Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 1330859Species Human (Homo sapiens) [TaxId:9606] [159290] (1 PDB entry)
    Uniprot Q16878 6-190
  8. 1330860Domain d2ic1a1: 2ic1 A:6-190 [147600]
    complexed with cys, fe2

Details for d2ic1a1

PDB Entry: 2ic1 (more details), 2.7 Å

PDB Description: Crystal Structure of Human Cysteine Dioxygenase in Complex with Substrate Cysteine
PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d2ic1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ic1a1 b.82.1.19 (A:6-190) Cysteine dioxygenase type I {Human (Homo sapiens) [TaxId: 9606]}
vlkprtladlirilhqlfagdevnveevqaimeayesdptewamyakfdqyrytrnlvdq
gngkfnlmilcwgeghgssihdhtnshcflkmlqgnlketlfawpdkksnemvkkservl
renqcayindsiglhrvenishtepavslhlysppfdtchafdqrtghknkvtmtfhskf
girtp

SCOPe Domain Coordinates for d2ic1a1:

Click to download the PDB-style file with coordinates for d2ic1a1.
(The format of our PDB-style files is described here.)

Timeline for d2ic1a1: