![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins) Pfam PF05995, CDO_I |
![]() | Protein Cysteine dioxygenase type I [141616] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [159290] (15 PDB entries) Uniprot Q16878 6-190 |
![]() | Domain d2ic1a1: 2ic1 A:6-190 [147600] complexed with cys, fe2 |
PDB Entry: 2ic1 (more details), 2.7 Å
SCOPe Domain Sequences for d2ic1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ic1a1 b.82.1.19 (A:6-190) Cysteine dioxygenase type I {Human (Homo sapiens) [TaxId: 9606]} vlkprtladlirilhqlfagdevnveevqaimeayesdptewamyakfdqyrytrnlvdq gngkfnlmilcwgeghgssihdhtnshcflkmlqgnlketlfawpdkksnemvkkservl renqcayindsiglhrvenishtepavslhlysppfdtchafdqrtghknkvtmtfhskf girtp
Timeline for d2ic1a1: