SCOP 1.75: Domain d2ic1a1: 2ic1 A:6-190

Lineage for d2ic1a1 (2ic1 A:6-190)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (24 families)

5. Family b.82.1.19: Cysteine dioxygenase type I [141615] (1 protein)
   Pfam PF05995, CDO_I

6. Protein Cysteine dioxygenase type I [141616] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159290] (1 PDB entry)
   Uniprot Q16878 6-190

8. Domain d2ic1a1: 2ic1 A:6-190 [147600]
   complexed with cys, fe2

Details for d2ic1a1

PDB Entry: 2ic1, 2.7 Å

PDB Description: Crystal Structure of Human Cysteine Dioxygenase in Complex with Substrate Cysteine

PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOP Domain Sequences for d2ic1a1:

Sequence; same for both SEQRES and ATOM records:

>d2ic1a1 b.82.1.19 (A:6-190) Cysteine dioxygenase type I {Human (Homo sapiens) [TaxId: 9606]}
vlkprtladlirilhqlfagdevnveevqaimeayesdptewamyakfdqyrytrnlvdq
gngkfnlmilcwgeghgssihdhtnshcflkmlqgnlketlfawpdkksnemvkkservl
renqcayindsiglhrvenishtepavslhlysppfdtchafdqrtghknkvtmtfhskf
girtp

Timeline for d2ic1a1:

• d2ic1a1 is new in SCOP 1.75
  
• d2ic1a1 appears in SCOPe 2.01
  
• d2ic1a1 appears in the current release, SCOPe 2.08