Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.9: Rv2844-like [158411] (1 protein) PfamB PB061364 |
Protein Hypothetical protein Rv2844 [158412] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [158413] (1 PDB entry) Uniprot O05815 17-158 |
Domain d2ib0a1: 2ib0 A:17-158 [147597] |
PDB Entry: 2ib0 (more details), 2 Å
SCOPe Domain Sequences for d2ib0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ib0a1 a.25.1.9 (A:17-158) Hypothetical protein Rv2844 {Mycobacterium tuberculosis [TaxId: 1773]} segsadnaalcdalavehatiygygivsalsppgvnflvadalkqhrhrrddvivmlsar gvtapiaaagyqlpmqvssaadaarlavrmendgatawravvehaetaddrvfastalte savmatrwnrvlgawpitaafp
Timeline for d2ib0a1: