Lineage for d2ib0b_ (2ib0 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703890Family a.25.1.9: Rv2844-like [158411] (1 protein)
    PfamB PB061364
  6. 2703891Protein Hypothetical protein Rv2844 [158412] (1 species)
  7. 2703892Species Mycobacterium tuberculosis [TaxId:1773] [158413] (1 PDB entry)
    Uniprot O05815 17-158
  8. 2703894Domain d2ib0b_: 2ib0 B: [161461]
    automated match to d2ib0a1

Details for d2ib0b_

PDB Entry: 2ib0 (more details), 2 Å

PDB Description: crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis
PDB Compounds: (B:) conserved hypothetical alanine rich protein

SCOPe Domain Sequences for d2ib0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ib0b_ a.25.1.9 (B:) Hypothetical protein Rv2844 {Mycobacterium tuberculosis [TaxId: 1773]}
segsadnaalcdalavehatiygygivsalsppgvnflvadalkqhrhrrddvivmlsar
gvtapiaaagyqlpmqvssaadaarlavrmendgatawravvehaetaddrvfastalte
savmatrwnrvl

SCOPe Domain Coordinates for d2ib0b_:

Click to download the PDB-style file with coordinates for d2ib0b_.
(The format of our PDB-style files is described here.)

Timeline for d2ib0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ib0a1