SCOPe 2.08: Domain d2ib0b_: 2ib0 B:

Lineage for d2ib0b_ (2ib0 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.9: Rv2844-like [158411] (1 protein)
   PfamB PB061364

6. Protein Hypothetical protein Rv2844 [158412] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [158413] (1 PDB entry)
   Uniprot O05815 17-158

8. Domain d2ib0b_: 2ib0 B: [161461]
   automated match to d2ib0a1

Details for d2ib0b_

PDB Entry: 2ib0, 2 Å

PDB Description: crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis

PDB Compounds: (B:) conserved hypothetical alanine rich protein

SCOPe Domain Sequences for d2ib0b_:

Sequence; same for both SEQRES and ATOM records:

>d2ib0b_ a.25.1.9 (B:) Hypothetical protein Rv2844 {Mycobacterium tuberculosis [TaxId: 1773]}
segsadnaalcdalavehatiygygivsalsppgvnflvadalkqhrhrrddvivmlsar
gvtapiaaagyqlpmqvssaadaarlavrmendgatawravvehaetaddrvfastalte
savmatrwnrvl

Timeline for d2ib0b_:

• d2ib0b_ first appeared in SCOPe 2.01
  
• d2ib0b_ appears in SCOPe 2.07