SCOP 1.75: Domain d2i9wa1: 2i9w A:46-158

Lineage for d2i9wa1 (2i9w A:46-158)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (30 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.30: SEC-C associated NTF2-like domain [160050] (1 protein)
   there is a C-terminal SEC-C motif, also there can be an additional SEC-C like motif at the N-terminus (there is only C-terminal motif in the new entry 2JQ5)

6. Protein Hypothetical protein Psyc2064 [160051] (1 species)

7. Species Psychrobacter arcticus [TaxId:334543] [160052] (1 PDB entry)
   Uniprot Q4FPZ7 46-158

8. Domain d2i9wa1: 2i9w A:46-158 [147576]
   Other proteins in same PDB: d2i9wa2, d2i9wa3
   complexed with cl, zn

Details for d2i9wa1

PDB Entry: 2i9w, 1.75 Å

PDB Description: crystal structure of a sec-c motif containing protein (psyc_2064) from psychrobacter arcticus at 1.75 a resolution

PDB Compounds: (A:) hypothetical protein

SCOP Domain Sequences for d2i9wa1:

Sequence; same for both SEQRES and ATOM records:

>d2i9wa1 d.17.4.30 (A:46-158) Hypothetical protein Psyc2064 {Psychrobacter arcticus [TaxId: 334543]}
airadtaehlmrtrysafvlvkpeyivkttlpaqqdlldikaienwaketdwaglevvah
tpklskrhaqvefkayfktpdglqahhelstfvkiknkansdaswyfldptvs

Timeline for d2i9wa1:

• d2i9wa1 is new in SCOP 1.75
  
• d2i9wa1 appears in SCOPe 2.01
  
• d2i9wa1 appears in the current release, SCOPe 2.08