![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.30: SEC-C associated NTF2-like domain [160050] (1 protein) there is a C-terminal SEC-C motif, also there can be an additional SEC-C like motif at the N-terminus (there is only C-terminal motif in the new entry 2JQ5) |
![]() | Protein Hypothetical protein Psyc2064 [160051] (1 species) |
![]() | Species Psychrobacter arcticus [TaxId:334543] [160052] (1 PDB entry) Uniprot Q4FPZ7 46-158 |
![]() | Domain d2i9wa1: 2i9w A:46-158 [147576] Other proteins in same PDB: d2i9wa2, d2i9wa3 complexed with cl, zn |
PDB Entry: 2i9w (more details), 1.75 Å
SCOPe Domain Sequences for d2i9wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i9wa1 d.17.4.30 (A:46-158) Hypothetical protein Psyc2064 {Psychrobacter arcticus [TaxId: 334543]} airadtaehlmrtrysafvlvkpeyivkttlpaqqdlldikaienwaketdwaglevvah tpklskrhaqvefkayfktpdglqahhelstfvkiknkansdaswyfldptvs
Timeline for d2i9wa1: