Lineage for d2i9ub2 (2i9u B:67-376)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 971605Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 971963Family c.1.9.9: SAH/MTA deaminase-like [82258] (3 proteins)
  6. 971964Protein Guanine deaminase [159391] (3 species)
  7. 971967Species Clostridium acetobutylicum [TaxId:1488] [159392] (1 PDB entry)
    Uniprot Q97MB6 64-373
    CAC0282
  8. 971969Domain d2i9ub2: 2i9u B:67-376 [147575]
    Other proteins in same PDB: d2i9ua1, d2i9ub1
    automatically matched to 2I9U A:67-376
    complexed with fe, gol, gun

Details for d2i9ub2

PDB Entry: 2i9u (more details), 2.05 Å

PDB Description: crystal structure of guanine deaminase from c. acetobutylicum with bound guanine in the active site
PDB Compounds: (B:) Cytosine/guanine deaminase related protein

SCOPe Domain Sequences for d2i9ub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i9ub2 c.1.9.9 (B:67-376) Guanine deaminase {Clostridium acetobutylicum [TaxId: 1488]}
pgmndlhahasqyknlgigmdkellpwlnnytfpeeakflnvdyakktygrlikdlikng
ttrvalfatlhkdstielfnmliksgigayvgkvnmdyncpdyltenyitslndteeiil
kykdksnivkpiitprfvpscsnelmdglgklsykyrlpvqshlsenldeiavvkslhkk
snfygevydkfglfgntptlmahcihsskeeinlikrnnvtivhcptsnfnlgsgmmpvr
kylnlginvvlgsdisaghtcslfkviayaiqnskikwqesgkkdmflstseafymatkk
ggsffgkvgs

SCOPe Domain Coordinates for d2i9ub2:

Click to download the PDB-style file with coordinates for d2i9ub2.
(The format of our PDB-style files is described here.)

Timeline for d2i9ub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i9ub1