SCOPe 2.08: Domain d2i9ub2: 2i9u B:67-376

Lineage for d2i9ub2 (2i9u B:67-376)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.9: SAH/MTA deaminase-like [82258] (3 proteins)
   automatically mapped to Pfam PF01979

6. Protein Guanine deaminase [159391] (3 species)

7. Species Clostridium acetobutylicum [TaxId:1488] [159392] (1 PDB entry)
   Uniprot Q97MB6 64-373
   CAC0282

8. Domain d2i9ub2: 2i9u B:67-376 [147575]
   Other proteins in same PDB: d2i9ua1, d2i9ub1
   automated match to d2i9ua2
   complexed with fe, gol, gun

Details for d2i9ub2

PDB Entry: 2i9u, 2.05 Å

PDB Description: crystal structure of guanine deaminase from c. acetobutylicum with bound guanine in the active site

PDB Compounds: (B:) Cytosine/guanine deaminase related protein

SCOPe Domain Sequences for d2i9ub2:

Sequence; same for both SEQRES and ATOM records:

>d2i9ub2 c.1.9.9 (B:67-376) Guanine deaminase {Clostridium acetobutylicum [TaxId: 1488]}
pgmndlhahasqyknlgigmdkellpwlnnytfpeeakflnvdyakktygrlikdlikng
ttrvalfatlhkdstielfnmliksgigayvgkvnmdyncpdyltenyitslndteeiil
kykdksnivkpiitprfvpscsnelmdglgklsykyrlpvqshlsenldeiavvkslhkk
snfygevydkfglfgntptlmahcihsskeeinlikrnnvtivhcptsnfnlgsgmmpvr
kylnlginvvlgsdisaghtcslfkviayaiqnskikwqesgkkdmflstseafymatkk
ggsffgkvgs

Timeline for d2i9ub2:

• d2i9ub2 first appeared in SCOP 1.75
  
• d2i9ub2 appears in SCOPe 2.07