Class b: All beta proteins [48724] (174 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.4: SAH/MTA deaminase-like [82224] (3 proteins) |
Protein Guanine deaminase [159336] (3 species) |
Species Clostridium acetobutylicum [TaxId:1488] [159339] (1 PDB entry) Uniprot Q97MB6 6-63,374-424 |
Domain d2i9ub1: 2i9u B:9-66,B:377-427 [147574] Other proteins in same PDB: d2i9ua2, d2i9ub2 automatically matched to 2I9U A:9-66,A:377-427 complexed with fe, gol, gun |
PDB Entry: 2i9u (more details), 2.05 Å
SCOPe Domain Sequences for d2i9ub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i9ub1 b.92.1.4 (B:9-66,B:377-427) Guanine deaminase {Clostridium acetobutylicum [TaxId: 1488]} nlkifkgnliftktsdkftimkdsyivvidgkiasvssnlpdkykgnpiidfrnniiiXf eegydfdalvindsnlypedydlterlerfiylgddrnimkryvcgneif
Timeline for d2i9ub1: