SCOPe 2.08: Domain d2i9ub1: 2i9u B:9-66,B:377-427

Lineage for d2i9ub1 (2i9u B:9-66,B:377-427)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.4: SAH/MTA deaminase-like [82224] (3 proteins)

6. Protein Guanine deaminase [159336] (3 species)

7. Species Clostridium acetobutylicum [TaxId:1488] [159339] (1 PDB entry)
   Uniprot Q97MB6 6-63,374-424

8. Domain d2i9ub1: 2i9u B:9-66,B:377-427 [147574]
   Other proteins in same PDB: d2i9ua2, d2i9ub2
   automated match to d2i9ua1
   complexed with fe, gol, gun

Details for d2i9ub1

PDB Entry: 2i9u, 2.05 Å

PDB Description: crystal structure of guanine deaminase from c. acetobutylicum with bound guanine in the active site

PDB Compounds: (B:) Cytosine/guanine deaminase related protein

SCOPe Domain Sequences for d2i9ub1:

Sequence; same for both SEQRES and ATOM records:

>d2i9ub1 b.92.1.4 (B:9-66,B:377-427) Guanine deaminase {Clostridium acetobutylicum [TaxId: 1488]}
nlkifkgnliftktsdkftimkdsyivvidgkiasvssnlpdkykgnpiidfrnniiiXf
eegydfdalvindsnlypedydlterlerfiylgddrnimkryvcgneif

Timeline for d2i9ub1:

• d2i9ub1 first appeared in SCOP 1.75
  
• d2i9ub1 appears in SCOPe 2.07