| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.22: ASF1-like [101546] (1 family) ![]() contains extra C-terminal strand |
| Family b.1.22.1: ASF1-like [101547] (1 protein) |
| Protein Anti-silencing protein 1, ASF1 [101548] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [158910] (4 PDB entries) Uniprot Q6IA08 1-154! Uniprot Q9Y294 1-154! Uniprot Q9Y294 1-156 |
| Domain d2i32b1: 2i32 B:1-154 [147496] automatically matched to 2I32 A:1-154 |
PDB Entry: 2i32 (more details), 2.7 Å
SCOPe Domain Sequences for d2i32b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i32b1 b.1.22.1 (B:1-154) Anti-silencing protein 1, ASF1 {Human (Homo sapiens) [TaxId: 9606]}
makvqvnnvvvldnpspfynpfqfeitfeciedlsedlewkiiyvgsaeseeydqvldsv
lvgpvpagrhmfvfqadapnpglipdadavgvtvvlitctyrgqefirvgyyvnneytet
elrenppvkpdfsklqrnilasnprvtrfhinwe
Timeline for d2i32b1: